PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA01G13580.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 489aa    MW: 52667.2 Da    PI: 7.0259
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA01G13580.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.41.5e-38109169262
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                      ++k+l+cprC+s++tkfCy+nny+++qPr+fC++C+ryWt+GGa+rnvPvG+grr+nk++s
  ONIVA01G13580.1 109 PDKILPCPRCNSMETKFCYFNNYNVHQPRHFCRNCQRYWTAGGAMRNVPVGAGRRRNKHVS 169
                      7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-31106166IPR003851Zinc finger, Dof-type
PfamPF027012.4E-31111167IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.602113167IPR003851Zinc finger, Dof-type
PROSITE patternPS013610115151IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MAALRQGDDP AIKLFGRTIP LLLDPAAAAA AADEVMPNLG NGVKTNNDLP LVSDKLLIVK  60
GIPFCPNNSK KNDLQGISRP DGRIEIDSMT EDVKTEPDGS VPEKILKKPD KILPCPRCNS  120
METKFCYFNN YNVHQPRHFC RNCQRYWTAG GAMRNVPVGA GRRRNKHVSK YCQAMMTCNN  180
TVAPGDVSDV VHHQVITHGS SLLPATLKEN ETPTEFISEV PPCKSSASIL DIGEPNDTDL  240
VPLASGDNKE EKSCASSVVV SSCSENLMPD NAIMKEPNNR SGCCNGVALP FPTGPALVLP  300
WSLGWNSVAL MPATQCSMQP VLGLKDGIPC PPSWPPQLMV PAPGICTPVV PIPLVPPLWS  360
CFPGWPNGMW NAQCPGGNTT VLPSTAPNKI SCSGSSSLVL GKHSREESLQ EEEKTRNYLW  420
VPKTLRIDDP AEAAKSSIWA TLGIKPDDKG IFKSFQPNVA KNGTAPESPQ ALQANPAAFS  480
RSQSFQETT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0669840.0AK066984.1 Oryza sativa Japonica Group cDNA clone:J013091E10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635234.10.0PREDICTED: cyclic dof factor 2
TrEMBLA0A0E0FK210.0A0A0E0FK21_ORYNI; Uncharacterized protein
STRINGBGIOSGA003252-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.24e-62cycling DOF factor 2